DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes7

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:172 Identity:45/172 - (26%)
Similarity:70/172 - (40%) Gaps:56/172 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRV---A 78
            |:.|||:|::||.|:|..|:||:.|:::....|..:..|||||:|||..|.||:  ::.||   .
Mouse    14 KMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLR--ERSRVEPPG 76

  Fly    79 NPQSPPPDQVNLDK-FRAGYTQAAYEV------------SHIFSTVPGLDLKFGTHLMKQLGHQL 130
            .|:||..|...|.. :.:|:.:....:            |.:||.:.|                 
Mouse    77 VPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARSQLFSALHG----------------- 124

  Fly   131 KDMKQEEEIIDMAEEPVNLADQKRSKSPREEDIHHGEEVWRP 172
                                 .:|.|.||.|.:..|....||
Mouse   125 ---------------------YRRPKPPRPEAVDPGLPAPRP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 25/59 (42%)
ORANGE 91..135 CDD:128787 5/56 (9%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 26/60 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 9/60 (15%)
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.