DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and BHLHE41

DIOPT Version :10

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_110389.1 Gene:BHLHE41 / 79365 HGNCID:16617 Length:482 Species:Homo sapiens


Alignment Length:109 Identity:38/109 - (34%)
Similarity:58/109 - (53%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKA----- 71
            |:...|:...|:|:|||.|:|..:.:||||:.:.:..  ..:..||||.:||||:.:|||     
Human    41 TKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKL--TTLGHLEKAVVLELTLKHLKALTALT 103

  Fly    72 -QQQQRVANPQS-----PPPDQVNLDKFRAGYTQAAYEVSHIFS 109
             ||.|::...|:     ..|.|.:||.|.:|:...|.||....|
Human   104 EQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 27/70 (39%)
ORANGE 91..135 CDD:128787 7/19 (37%)
BHLHE41NP_110389.1 bHLH-O_DEC2 31..122 CDD:381593 28/82 (34%)
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 67..71 3/3 (100%)
ORANGE 129..175 CDD:128787 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.