DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:200 Identity:49/200 - (24%)
Similarity:83/200 - (41%) Gaps:48/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQ 73
            |...:...::.||::|:.||.|:|..:::|| |:::...|:.:..||||||||||:.|:|||..:
  Rat    10 MLSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLEQEFARHQPNSKLEKADILEMAVSYLKHSK 73

  Fly    74 QQ-----RVANP-------QSP--------------PPDQVNLDKFRAGYTQAAYEVSHIFSTVP 112
            .:     ||..|       ::|              .|..::.| :..||:....|.....:...
  Rat    74 GELGACARVLLPTGVAPTARAPLMPLGLPTAFAAAAGPKSLHQD-YSEGYSWCLQEAVQFLTLHA 137

  Fly   113 GLDLKFGTHLMKQLGHQLKDMK-----QEEEIIDMAEEPVNLADQKRSKSPREEDIHHGEE---- 168
            ..|.:     ||.|.|..:...     :|......|.:|.      ||.:.....:....:    
  Rat   138 ASDTQ-----MKLLYHFQRPPAPAAPVKETPTPGAAPQPA------RSSTKAAASVSTSRQSACG 191

  Fly   169 VWRPW 173
            :||||
  Rat   192 LWRPW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 26/72 (36%)
ORANGE 91..135 CDD:128787 9/48 (19%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 25/56 (45%)
ORANGE 116..158 CDD:128787 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.