DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes5.10

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001039178.1 Gene:hes5.10 / 734014 XenbaseID:XB-GENE-876529 Length:166 Species:Xenopus tropicalis


Alignment Length:173 Identity:47/173 - (27%)
Similarity:78/173 - (45%) Gaps:33/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TKTQ----HYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLK 70
            ||.|    ...|:.||::|:.||.|:|..:::|:.|:.......... ||||||||||:.|:||:
 Frog    12 TKAQLNDLKKNKIRKPVIEKMRRDRINHSIEQLRILLERNFQTHHPH-SKLEKADILEMAVSYLQ 75

  Fly    71 AQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQ 135
             ||::...|.....|:.|. |.:..||.....|      ||..|..:...|:.:    :.|::..
 Frog    76 -QQKKHQMNRSHLLPENVQ-DSYYQGYYMCLKE------TVGFLHTQENGHIQE----ENKNLTW 128

  Fly   136 EEEII-----DMAEEPVNLADQKRSKSPREEDIHHGEEVWRPW 173
            .:..:     .:.::.|:|.....|.           ::||||
 Frog   129 NDSCLPAPYQSLYQQRVSLQVSPGSM-----------KIWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 28/70 (40%)
ORANGE 91..135 CDD:128787 9/43 (21%)
hes5.10NP_001039178.1 bHLH-O_HES5 23..81 CDD:381467 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5183
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.