DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes7.1

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001039166.1 Gene:hes7.1 / 733997 XenbaseID:XB-GENE-876465 Length:178 Species:Xenopus tropicalis


Alignment Length:189 Identity:48/189 - (25%)
Similarity:84/189 - (44%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQGQRFMTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVN 67
            ::|...:...:.:||:.|||:||:||.|:|..|::|:..:...:.::..:..|:|||:|||.||.
 Frog     1 MKGASEVRPMEAHRKLLKPLVERRRRERINNSLEKLRIFLSQALKSEKLKNPKVEKAEILECTVQ 65

  Fly    68 YLKAQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKD 132
            :|::.:       ..|....|....:::|:........|..::.|  ||...|  ...|.|||..
 Frog    66 FLQSSK-------LVPQDGDVGNKGYQSGFQHCLETALHFMNSKP--DLNVAT--KDFLSHQLSS 119

  Fly   133 MKQEEEIIDMAEEP------------VNLADQKRSKSPREEDIHHGE------EVWRPW 173
            .|...|.....:.|            .:|:....|.|| .:.:..|:      :.||||
 Frog   120 YKPPAEAWSPTDTPKPTPSIGYQDSAPHLSSNTISVSP-TKTLVDGQFSPQTFQTWRPW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 23/67 (34%)
ORANGE 91..135 CDD:128787 10/43 (23%)
hes7.1NP_001039166.1 bHLH-O_HES7 14..74 CDD:381468 23/66 (35%)
Hairy_orange 84..121 CDD:369405 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..147 2/24 (8%)
WRPW motif. /evidence=ECO:0000255 174..177 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.