DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hey2

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_571697.2 Gene:hey2 / 58146 ZFINID:ZDB-GENE-000526-1 Length:324 Species:Danio rerio


Alignment Length:157 Identity:44/157 - (28%)
Similarity:72/157 - (45%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..:.::|::||.|:|..|.||:.|:....:.||.  :|||||:||::||::||  ..|.....
Zfish    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLK--MLQATGGK 109

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMAEE 145
            .......:.:|....|:.:...||:...|:|.|||  ....|..:|...|.....:.|...|.  
Zfish   110 GYFDAHSLAMDFLSIGFRECLTEVARYLSSVEGLD--SSDPLRVRLVSHLSSCASQREAAAMT-- 170

  Fly   146 PVNLADQKRSKSPREEDIHHGEEVWRP 172
             .::|..:::..|     ||......|
Zfish   171 -TSIAHHQQALHP-----HHWAAALHP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 25/60 (42%)
ORANGE 91..135 CDD:128787 12/43 (28%)
hey2NP_571697.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
HLH 49..105 CDD:238036 24/59 (41%)
Hairy_orange 125..162 CDD:284859 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..324
YRPW motif 314..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.