DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her8.2

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:198 Identity:60/198 - (30%)
Similarity:89/198 - (44%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||:.|||:|||||.|:||.||:|::.:|...  :.:| ||||||||||:||.:|:..|..||::|
Zfish    23 RKLRKPLIERKRRERINLCLDQLRETVVAVF--KPDQ-SKLEKADILEMTVKHLQNIQSSRVSDP 84

  Fly    81 QSPPPDQVNL---DKFRAGYTQAAYEVSHIFSTVPGLDLKFGT----HLMKQLGHQLKDMKQEEE 138
                  .:|.   .::..||.|...||.::..:...:|...|:    ||.|.|....||..:..:
Zfish    85 ------VLNTGARQRYSTGYIQCMQEVHNLLHSCDWMDKTLGSRLLNHLFKSLPLSAKDCPRLPK 143

  Fly   139 I------IDMAEEPVNLADQKRS-----------KSPREEDIHHGE----------------EVW 170
            .      .|.:|......|:..|           |.|.:....|..                ::|
Zfish   144 TSLTSVPSDHSEYSSFHVDETASPKPCSSSPFLCKRPNQSQNQHFTPIRMPHDVESSHLSVLQMW 208

  Fly   171 RPW 173
            |||
Zfish   209 RPW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 32/60 (53%)
ORANGE 91..135 CDD:128787 13/47 (28%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 31/56 (55%)
Hairy_orange 94..132 CDD:284859 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573654
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.