Sequence 1: | NP_524503.2 | Gene: | E(spl)mdelta-HLH / 43150 | FlyBaseID: | FBgn0002734 | Length: | 173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001159638.1 | Gene: | her8.2 / 565269 | ZFINID: | ZDB-GENE-060815-4 | Length: | 211 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 60/198 - (30%) |
---|---|---|---|
Similarity: | 89/198 - (44%) | Gaps: | 49/198 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
Fly 81 QSPPPDQVNL---DKFRAGYTQAAYEVSHIFSTVPGLDLKFGT----HLMKQLGHQLKDMKQEEE 138
Fly 139 I------IDMAEEPVNLADQKRS-----------KSPREEDIHHGE----------------EVW 170
Fly 171 RPW 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mdelta-HLH | NP_524503.2 | bHLH-O_ESMB_like | 9..77 | CDD:381584 | 32/60 (53%) |
ORANGE | 91..135 | CDD:128787 | 13/47 (28%) | ||
her8.2 | NP_001159638.1 | HLH | 20..77 | CDD:238036 | 31/56 (55%) |
Hairy_orange | 94..132 | CDD:284859 | 10/37 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573654 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 92 | 1.000 | Inparanoid score | I5073 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.850 |