DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Heyl

DIOPT Version :10

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_038933.2 Gene:Heyl / 56198 MGIID:1860511 Length:326 Species:Mus musculus


Alignment Length:55 Identity:24/55 - (43%)
Similarity:39/55 - (70%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLK 70
            ||..:.::|::||.|:|..|.||:.|:....:.||.  ||||||::|::||::||
Mouse    44 RKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVLQMTVDHLK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 24/55 (44%)
ORANGE 91..135 CDD:128787
HeylNP_038933.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 3/11 (27%)
bHLH-O_HEYL 36..109 CDD:381453 24/55 (44%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 24/55 (44%)
ORANGE 115..162 CDD:128787
PHA03247 <161..306 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..260
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..306
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.