DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes6

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_062352.1 Gene:Hes6 / 55927 MGIID:1859852 Length:224 Species:Mus musculus


Alignment Length:215 Identity:54/215 - (25%)
Similarity:87/215 - (40%) Gaps:73/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYL------KAQQQ 74
            ||..|||:|:|||||:|..|.||:.|:..|     |..:|||.|::|||||..:      :|:::
Mouse    26 RKARKPLVEKKRRARINESLQELRLLLAGT-----EVQAKLENAEVLELTVRRVQGALRGRARER 85

  Fly    75 QRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEE-- 137
            :::....|        ::|.|||.|..:||....||...:|......|   |.|.|:.|...|  
Mouse    86 EQLQAEAS--------ERFAAGYIQCMHEVHTFVSTCQAIDATVSAEL---LNHLLESMPLREGS 139

  Fly   138 ---EII----------------------------------DMAEEPVNLADQKRSKSPRE-EDI- 163
               :::                                  |:..:...:.:.:.::.|.| .|: 
Mouse   140 SFQDLLGDSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLV 204

  Fly   164 ----------HHGEEVWRPW 173
                      ...:.|||||
Mouse   205 STSLGSLTAARRAQSVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 28/66 (42%)
ORANGE 91..135 CDD:128787 15/43 (35%)
Hes6NP_062352.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/4 (50%)
bHLH_SF 24..81 CDD:412148 27/59 (46%)
Hairy_orange 96..134 CDD:400076 14/40 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..209 4/62 (6%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.