Sequence 1: | NP_524503.2 | Gene: | E(spl)mdelta-HLH / 43150 | FlyBaseID: | FBgn0002734 | Length: | 173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062352.1 | Gene: | Hes6 / 55927 | MGIID: | 1859852 | Length: | 224 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 54/215 - (25%) |
---|---|---|---|
Similarity: | 87/215 - (40%) | Gaps: | 73/215 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYL------KAQQQ 74
Fly 75 QRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEE-- 137
Fly 138 ---EII----------------------------------DMAEEPVNLADQKRSKSPRE-EDI- 163
Fly 164 ----------HHGEEVWRPW 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mdelta-HLH | NP_524503.2 | bHLH-O_ESMB_like | 9..77 | CDD:381584 | 28/66 (42%) |
ORANGE | 91..135 | CDD:128787 | 15/43 (35%) | ||
Hes6 | NP_062352.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | 2/4 (50%) | |
bHLH_SF | 24..81 | CDD:412148 | 27/59 (46%) | ||
Hairy_orange | 96..134 | CDD:400076 | 14/40 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..209 | 4/62 (6%) | |||
WRPW motif | 221..224 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830827 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
5 | 4.700 |