Sequence 1: | NP_524503.2 | Gene: | E(spl)mdelta-HLH / 43150 | FlyBaseID: | FBgn0002734 | Length: | 173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061115.2 | Gene: | HES6 / 55502 | HGNCID: | 18254 | Length: | 224 | Species: | Homo sapiens |
Alignment Length: | 224 | Identity: | 58/224 - (25%) |
---|---|---|---|
Similarity: | 90/224 - (40%) | Gaps: | 81/224 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 KTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYL------ 69
Fly 70 KAQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMK 134
Fly 135 QEE-----EII--------------------------------------DMAEEPVNLADQKRSK 156
Fly 157 SPRE-EDI-----------HHGEEVWRPW 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mdelta-HLH | NP_524503.2 | bHLH-O_ESMB_like | 9..77 | CDD:381584 | 29/71 (41%) |
ORANGE | 91..135 | CDD:128787 | 15/43 (35%) | ||
HES6 | NP_061115.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | 3/9 (33%) | |
HLH | 23..75 | CDD:238036 | 27/56 (48%) | ||
Hairy_orange | 96..134 | CDD:311465 | 14/40 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 147..205 | 7/61 (11%) | |||
WRPW motif | 221..224 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140864 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.700 |