DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and HES6

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_061115.2 Gene:HES6 / 55502 HGNCID:18254 Length:224 Species:Homo sapiens


Alignment Length:224 Identity:58/224 - (25%)
Similarity:90/224 - (40%) Gaps:81/224 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYL------ 69
            :|:..||..|||:|:|||||:|..|.||:.|:     |..|..:|||.|::|||||..:      
Human    21 ETRGDRKARKPLVEKKRRARINESLQELRLLL-----AGAEVQAKLENAEVLELTVRRVQGVLRG 80

  Fly    70 KAQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMK 134
            :|::::::....|        ::|.|||.|..:||....||...:|......|   |.|.|:.|.
Human    81 RAREREQLQAEAS--------ERFAAGYIQCMHEVHTFVSTCQAIDATVAAEL---LNHLLESMP 134

  Fly   135 QEE-----EII--------------------------------------DMAEEPVNLADQKRSK 156
            ..|     :::                                      |:.|.|    :.:.|:
Human   135 LREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAP----EAELSQ 195

  Fly   157 SPRE-EDI-----------HHGEEVWRPW 173
            :|.| .|:           .....|||||
Human   196 APAEGPDLVPAALGSLTTAQIARSVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 29/71 (41%)
ORANGE 91..135 CDD:128787 15/43 (35%)
HES6NP_061115.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/9 (33%)
HLH 23..75 CDD:238036 27/56 (48%)
Hairy_orange 96..134 CDD:311465 14/40 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..205 7/61 (11%)
WRPW motif 221..224 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140864
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.