DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her13

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001017901.1 Gene:her13 / 550600 ZFINID:ZDB-GENE-050228-1 Length:224 Species:Danio rerio


Alignment Length:210 Identity:58/210 - (27%)
Similarity:90/210 - (42%) Gaps:62/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..||::|:|||||:|..|.:|:.|:.:. |.|    :|:|.|::|||||..:::..|.|  :.
Zfish    25 RKTRKPIVEKKRRARINESLQDLRTLLTNN-DLQ----TKMENAEVLELTVKRVESILQSR--SQ 82

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEE-----II 140
            ::....|...::|.|||.|..:||....||.||::.:....|   |.|.|:.|...|.     |.
Zfish    83 ETGTVTQEASERFAAGYIQCMHEVHTFVSTCPGIEARVAAEL---LNHLLESMPLNENHLHEMIK 144

  Fly   141 DMAEEPVNLADQKRS-----------------------------------------KSPREED-- 162
            |:..||.:..|..:|                                         :|...||  
Zfish   145 DLISEPSSSGDSWQSGEAQNPGRHCVSGMSSELPQFLSNPFCDDLCSDLDETETEERSASAEDTL 209

  Fly   163 ----IHHGEEVWRPW 173
                :.|.:.:||||
Zfish   210 DFSMVTHSKFMWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 25/60 (42%)
ORANGE 91..135 CDD:128787 16/43 (37%)
her13NP_001017901.1 HLH 22..71 CDD:238036 23/50 (46%)
Hairy_orange 95..133 CDD:284859 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.