DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and HES2

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:165 Identity:48/165 - (29%)
Similarity:77/165 - (46%) Gaps:12/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..|||||::||||:|..|.:||.||:..:..:....|||||||:||:||.:|  |:....:.|
Human    14 RKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFL--QELPASSWP 76

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTV----PGLDLKFGTHLMKQLGHQLKDMKQEEEIID 141
            .:.|   :..|.:|.||:.....::.:....    |.:..:...||.::......|..:..:...
Human    77 TAAP---LPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSG 138

  Fly   142 ---MAEEPVNLADQKRSKSPREEDIHHGEEVWRPW 173
               .|..|.:..:...:..|.......|..:||||
Human   139 PSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 30/60 (50%)
ORANGE 91..135 CDD:128787 8/47 (17%)
HES2NP_061962.2 HLH 12..70 CDD:238036 30/57 (53%)
ORANGE 84..127 CDD:128787 7/42 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 7/44 (16%)
WRPW motif 170..173 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5317
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.