DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Helt

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_008769494.1 Gene:Helt / 498633 RGDID:1564073 Length:241 Species:Rattus norvegicus


Alignment Length:113 Identity:33/113 - (29%)
Similarity:50/113 - (44%) Gaps:27/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYL------------- 69
            |:..::|::||.|:|..|:||...:...:..|..  .|||||:|||:||.||             
  Rat    13 VSHKVIEKRRRDRINRCLNELGKTVPMALAKQSS--GKLEKAEILEMTVQYLRALHSADFPRGRE 75

  Fly    70 KAQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLK 117
            ||:.....||            .|..||.:....:.|..:||..::.|
  Rat    76 KAELLAEFAN------------YFHYGYHECMKNLVHYLTTVERMETK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 24/71 (34%)
ORANGE 91..135 CDD:128787 7/27 (26%)
HeltXP_008769494.1 bHLH-O_HELT 14..69 CDD:381414 21/56 (38%)
Hairy_orange 87..127 CDD:400076 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.