DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes1

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001011194.1 Gene:hes1 / 496617 XenbaseID:XB-GENE-487995 Length:267 Species:Xenopus tropicalis


Alignment Length:126 Identity:51/126 - (40%)
Similarity:76/126 - (60%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQ 74
            |.::| ||.:||::|::||||:|..|.:||.||:|.:.....:.||||||||||:||.:|:..|:
 Frog    30 TASEH-RKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQR 93

  Fly    75 QRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQ 135
            .::....|..|..  |.|:|||:::...||:...||..|::....|.|   |||....|.|
 Frog    94 VQMTAALSTDPSV--LGKYRAGFSECMNEVTRFLSTCEGVNTDVRTRL---LGHLANCMNQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 32/66 (48%)
ORANGE 91..135 CDD:128787 15/43 (35%)
hes1NP_001011194.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 7/15 (47%)
bHLH-O_HES1_4 33..95 CDD:381465 31/62 (50%)
Hairy_orange 110..148 CDD:369405 13/40 (33%)
WRPW motif. /evidence=ECO:0000255 264..267
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.