DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her11

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001003886.1 Gene:her11 / 445409 ZFINID:ZDB-GENE-040824-4 Length:274 Species:Danio rerio


Alignment Length:94 Identity:36/94 - (38%)
Similarity:52/94 - (55%) Gaps:20/94 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIV-DTMDAQGEQVSKLEKADILELTVNYL--- 69
            ||||:..::..||::|:|||.|:|..||.|:||:. :|.|.: .|..|||||:||:|.|.|:   
Zfish     9 MTKTEGIKRRLKPVIEKKRRDRINHNLDALRDLLFKNTADTR-LQNPKLEKAEILDLAVQYIKKT 72

  Fly    70 ---------------KAQQQQRVANPQSP 83
                           |:.|.|.|.:|..|
Zfish    73 IRKTETARNSNQMDCKSTQNQFVISPAGP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 33/86 (38%)
ORANGE 91..135 CDD:128787
her11NP_001003886.1 HLH 16..71 CDD:238036 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.