DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:183 Identity:62/183 - (33%)
Similarity:94/183 - (51%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FMTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQ 72
            :.||||.|:||.||:|||:||||||..||.||.|:.:.....|  :.:::||::||..|.:::.|
  Fly     3 YTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDG--ILRMDKAEMLESAVIFMRQQ 65

  Fly    73 Q-QQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQE 136
            : .::||..:...|    ||.|:.||..|..|||.:.::.||:.:..|..:|..||...|:::|.
  Fly    66 KTPKKVAQEEQSLP----LDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQF 126

  Fly   137 EEIIDMAEEPVNLAD----QKRSKSPREEDIHHG------------EEVWRPW 173
            .|....|:...|..|    .|...||.....|..            :.:||||
  Fly   127 HEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 30/68 (44%)
ORANGE 91..135 CDD:128787 15/43 (35%)
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 26/58 (45%)
ORANGE 81..125 CDD:128787 15/43 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.