DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:190 Identity:64/190 - (33%)
Similarity:102/190 - (53%) Gaps:29/190 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVQGQR---FMTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQ-VSKLEKADI 61
            ||.|...   |::|||||.||.||||||:||||||..||.||.|:.   :.||:. :.:::||::
  Fly     1 MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVA---EFQGDDAILRMDKAEM 62

  Fly    62 LELTVNYLKAQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQL 126
            ||..:.:::.|..::.| |.||.|    :|.|:.||..|..|:|.:.:..|.:.:..|..:|..|
  Fly    63 LEAALVFMRKQVVKQQA-PVSPLP----MDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHL 122

  Fly   127 GHQLKDMKQEEE----IIDMAEEPVNLA---------DQKRSKSPREEDIHHGEEVWRPW 173
            |.:.:.|.|.::    :......|::.|         |.:.:.||:..:    |.:||||
  Fly   123 GVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVE----ETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 31/68 (46%)
ORANGE 91..135 CDD:128787 13/43 (30%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 25/54 (46%)
ORANGE 87..131 CDD:128787 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 1 0.950 - 0 Normalized mean entropy S5317
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.