DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:223 Identity:73/223 - (32%)
Similarity:106/223 - (47%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQ 73
            |:||..||||.|||||||||||:|..||:||||:|:.:..:||.|::|||||||||||::::..:
  Fly     5 MSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLK 69

  Fly    74 QQR-------VANPQSPP--PDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMK----- 124
            |:.       ||...|||  ....:::.||:||..||.:::.:.......| :.|..:||     
  Fly    70 QRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTD-EIGRKIMKFLSTR 133

  Fly   125 --------------QLGHQLKDMKQ------------------------------EEEIIDMAEE 145
                          |..||.:.:.|                              ::|:||:...
  Fly   134 LIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSV 198

  Fly   146 PVNLADQKRSKSPREEDIHHGEEVWRPW 173
            ..|...:..|.|.:|...  .|.|||||
  Fly   199 DGNALSETASVSSQESGA--SEPVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 41/74 (55%)
ORANGE 91..135 CDD:128787 13/62 (21%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 37/58 (64%)
ORANGE 96..136 CDD:128787 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469350
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.