DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:191 Identity:78/191 - (40%)
Similarity:109/191 - (57%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLK--- 70
            |:||..||||.||:||||||||:|..||||||::|:.:..:||.:::|||||||||||.::|   
  Fly     7 MSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLR 71

  Fly    71 AQQQQRVA------NPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQ 129
            ||:|.|::      :|.:.|...: .:.|||||..||.|||...:.|||:.:..||.||..|||:
  Fly    72 AQKQLRLSSVTGGVSPSADPKLSI-AESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHR 135

  Fly   130 LKDMK-----------QEEEIIDMA------EEPVNLADQKRSKSPREEDIHHGEEVWRPW 173
            |..::           .:..:.|.|      .|..:|.....|.:|.|.....| .:||||
  Fly   136 LNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSG-PMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 42/70 (60%)
ORANGE 91..135 CDD:128787 21/54 (39%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 38/61 (62%)
ORANGE 97..141 CDD:128787 21/43 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469353
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.