DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her12

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_991182.1 Gene:her12 / 402914 ZFINID:ZDB-GENE-040824-5 Length:155 Species:Danio rerio


Alignment Length:157 Identity:48/157 - (30%)
Similarity:70/157 - (44%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANPQ 81
            |:.||::|:.||.|:|..:|:||.|:.....:. :..:|||||||||:||::||.|.:|:...||
Zfish    23 KLRKPIVEKMRRDRINTCIDQLKSLLEKEFHSH-DPSTKLEKADILEMTVSFLKQQIKQQQQIPQ 86

  Fly    82 SPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMAEEP 146
            .         .|..||:....|..|..|    |....|     :|.|.....|...   .|...|
Zfish    87 R---------DFNEGYSHCWRESVHFLS----LHSNAG-----ELQHLHSGPKTNS---TMGSTP 130

  Fly   147 VNLADQKRSKSPREEDIHHGEEVWRPW 173
            .....:..:.:.:..|  ....|||||
Zfish   131 ATACSKLNTAALQHPD--SVRAVWRPW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 27/59 (46%)
ORANGE 91..135 CDD:128787 10/43 (23%)
her12NP_991182.1 HLH 19..74 CDD:238036 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.