DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes6

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:220 Identity:59/220 - (26%)
Similarity:86/220 - (39%) Gaps:75/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..|||:|:|||||:|..|.||:.|:.|. |||    .|:|.|::||:||..:::..|.:    
Zfish    20 RKTRKPLVEKKRRARINESLQELRLLLADP-DAQ----VKMENAEVLEMTVKRVESILQNK---- 75

  Fly    81 QSPPPDQVNL---DKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDM--KQEEEII 140
             :...|.||.   ::|.|||.|..:||....|:.||:|......|   |.|.|:.|  ..||...
Zfish    76 -AKEADSVNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADL---LNHLLECMPLNDEERFQ 136

  Fly   141 DMAEEPV--------------------------NLADQKRSKSPR------------EEDIHH-- 165
            |:..:.:                          |......|.:|.            :.|..|  
Zfish   137 DILSDLISDSNNSGTWPGEAAYATLSPGGTSVANGGSSALSPAPSTTSSDDICSDLDDTDTEHSR 201

  Fly   166 -----------------GEEVWRPW 173
                             .:.:||||
Zfish   202 ISVDAGDQAPVVPTLYTNKSIWRPW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 28/60 (47%)
ORANGE 91..135 CDD:128787 16/45 (36%)
hes6NP_919381.2 HLH 18..75 CDD:238036 28/59 (47%)
Hairy_orange 90..128 CDD:284859 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573606
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.