Sequence 1: | NP_524503.2 | Gene: | E(spl)mdelta-HLH / 43150 | FlyBaseID: | FBgn0002734 | Length: | 173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_919381.2 | Gene: | hes6 / 373116 | ZFINID: | ZDB-GENE-030828-5 | Length: | 226 | Species: | Danio rerio |
Alignment Length: | 220 | Identity: | 59/220 - (26%) |
---|---|---|---|
Similarity: | 86/220 - (39%) | Gaps: | 75/220 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
Fly 81 QSPPPDQVNL---DKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDM--KQEEEII 140
Fly 141 DMAEEPV--------------------------NLADQKRSKSPR------------EEDIHH-- 165
Fly 166 -----------------GEEVWRPW 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mdelta-HLH | NP_524503.2 | bHLH-O_ESMB_like | 9..77 | CDD:381584 | 28/60 (47%) |
ORANGE | 91..135 | CDD:128787 | 16/45 (36%) | ||
hes6 | NP_919381.2 | HLH | 18..75 | CDD:238036 | 28/59 (47%) |
Hairy_orange | 90..128 | CDD:284859 | 15/40 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573606 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 92 | 1.000 | Inparanoid score | I5073 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.750 |