DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hesr

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster


Alignment Length:167 Identity:49/167 - (29%)
Similarity:80/167 - (47%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQ 74
            :::..||:|.||::|||||:|:|..||.:|||:.:.....||.::|::..|:|||.|::| :::.
  Fly    16 SRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHL-SKKN 79

  Fly    75 QRVANPQSPPPD---QVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQE 136
            ..||.|.:.|..   |..:|.:.:|:.:...|||. |....|....|  ...|:|.|.       
  Fly    80 CPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQ-FLQHNGYQPSF--EFAKELDHL------- 134

  Fly   137 EEIIDMAEEPVNLADQKRSKSPREEDIHHGEEVWRPW 173
                        :|...:||          ..:||||
  Fly   135 ------------VASTSKSK----------PNLWRPW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 26/66 (39%)
ORANGE 91..135 CDD:128787 11/43 (26%)
HesrNP_525094.1 HLH 21..77 CDD:238036 26/56 (46%)
Hairy_orange 101..>116 CDD:295407 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469374
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.