Sequence 1: | NP_524503.2 | Gene: | E(spl)mdelta-HLH / 43150 | FlyBaseID: | FBgn0002734 | Length: | 173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955918.3 | Gene: | her8a / 323656 | ZFINID: | ZDB-GENE-030131-2376 | Length: | 221 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 58/215 - (26%) |
---|---|---|---|
Similarity: | 90/215 - (41%) | Gaps: | 52/215 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 QRFMTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLK 70
Fly 71 -AQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFG----THLMKQLGHQL 130
Fly 131 KDMKQEEEI-------IDMAEEPVNLADQKR------SKSPREEDIHH----------------- 165
Fly 166 ------------GEEVWRPW 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mdelta-HLH | NP_524503.2 | bHLH-O_ESMB_like | 9..77 | CDD:381584 | 30/68 (44%) |
ORANGE | 91..135 | CDD:128787 | 14/47 (30%) | ||
her8a | NP_955918.3 | HLH | 17..75 | CDD:238036 | 29/62 (47%) |
Hairy_orange | 95..133 | CDD:284859 | 12/37 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573653 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 92 | 1.000 | Inparanoid score | I5073 |
OMA | 1 | 1.010 | - | - | QHG47782 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.860 |