DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her8a

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:215 Identity:58/215 - (26%)
Similarity:90/215 - (41%) Gaps:52/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRFMTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLK 70
            :.|..|.:  ||:.|||:|:|||.|:|..|::||.::|   ||.....|||||||:||:||.:::
Zfish    12 KNFNAKEE--RKLRKPLIEKKRRERINSSLEQLKGIMV---DAYNLDQSKLEKADVLEITVQHME 71

  Fly    71 -AQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFG----THLMKQLGHQL 130
             .|:........||.....:..::.:||.|..:||.::..:.||:|...|    .||:|.|.|..
Zfish    72 NLQRGHGQGGSNSPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHLLKSLPHIS 136

  Fly   131 KDMKQEEEI-------IDMAEEPVNLADQKR------SKSPREEDIHH----------------- 165
            .:.......       :...:.|:||....:      |.||.....|.                 
Zfish   137 TEPSGTSSAGTSSPLPLSPTQSPINLPSSLQPHALLLSPSPPSSPTHSLVRPREQSSPPSSPSPQ 201

  Fly   166 ------------GEEVWRPW 173
                        ...:||||
Zfish   202 SPASLPPFFPGVDPSMWRPW 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 30/68 (44%)
ORANGE 91..135 CDD:128787 14/47 (30%)
her8aNP_955918.3 HLH 17..75 CDD:238036 29/62 (47%)
Hairy_orange 95..133 CDD:284859 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.