powered by:
Protein Alignment E(spl)mdelta-HLH and Heyl
DIOPT Version :9
Sequence 1: | NP_524503.2 |
Gene: | E(spl)mdelta-HLH / 43150 |
FlyBaseID: | FBgn0002734 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101447.1 |
Gene: | Heyl / 313575 |
RGDID: | 1305022 |
Length: | 326 |
Species: | Rattus norvegicus |
Alignment Length: | 55 |
Identity: | 24/55 - (43%) |
Similarity: | 39/55 - (70%) |
Gaps: | 2/55 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLK 70
||..:.::|::||.|:|..|.||:.|:....:.||. ||||||::|::||::||
Rat 44 RKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVLQMTVDHLK 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166334592 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4304 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.