DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her1

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_571153.1 Gene:her1 / 30287 ZFINID:ZDB-GENE-980526-125 Length:328 Species:Danio rerio


Alignment Length:144 Identity:40/144 - (27%)
Similarity:68/144 - (47%) Gaps:39/144 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVD-TMDAQGEQVSKLEKADILELTVNYLKAQ 72
            |...:..:::.||::|:|||.|:|..|:||:.|::| |:|:: .|..|||||:||||.|.|::.:
Zfish     6 MASRRPTKRILKPVIEKKRRDRINQRLEELRTLLLDNTLDSR-LQNPKLEKAEILELAVEYIRTK 69

  Fly    73 ---------QQQRVANPQSPP-------------PDQVNLDK------FRAGYTQA--------- 100
                     ..:...:|:.||             |:.:....      ::||:.:.         
Zfish    70 TATARDQGDSSKDTHDPKPPPLLSRRPQMPCASIPESIQTHNSPSNPIYKAGFKECISRSASFID 134

  Fly   101 AYEVSHIFSTVPGL 114
            ..|.|...|.|.||
Zfish   135 CVEPSQRDSFVQGL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 28/77 (36%)
ORANGE 91..135 CDD:128787 8/39 (21%)
her1NP_571153.1 HLH 10..67 CDD:238036 27/57 (47%)
Hairy_orange 118..157 CDD:284859 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.