DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her5

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_571152.1 Gene:her5 / 30285 ZFINID:ZDB-GENE-990415-90 Length:205 Species:Danio rerio


Alignment Length:207 Identity:46/207 - (22%)
Similarity:85/207 - (41%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQ----- 75
            |:|.|||:|::||.|:|..|:.|:.|:::..:.:..:..|:|||:|||..|::|:|:|..     
Zfish     7 RRVPKPLMEKRRRDRINQSLETLRMLLLENTNNEKLKNPKVEKAEILESVVHFLRAEQASETDPF 71

  Fly    76 ---RVANPQSPPPDQ-----VNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKD 132
               ||...::...|:     .....:..|.......||:.   :.|...:||..|.|...:..|.
Zfish    72 QITRVKRARTEESDEDVESPCKRQSYHDGMRTCLLRVSNF---ITGKSHEFGQELEKACENIHKS 133

  Fly   133 MKQEEEII---DMAEEPVNLADQKRSKSPREEDIHH----------------------------- 165
            ..::.:::   .:.|..|:|.:     .|.::.:.|                             
Zfish   134 HSRQVQLLSTPSLIEPQVHLYE-----DPSQQHLAHVQLSNSCTPSGCSKLAQRTVPAMTSSPKQ 193

  Fly   166 ----GEEVWRPW 173
                .:.|||||
Zfish   194 PVMLCDPVWRPW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 24/68 (35%)
ORANGE 91..135 CDD:128787 9/43 (21%)
her5NP_571152.1 HLH 4..67 CDD:238036 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573712
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.