DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes1

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus


Alignment Length:126 Identity:51/126 - (40%)
Similarity:77/126 - (61%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQ 74
            |.::| ||.:||::|::||||:|..|.:||.||:|.:.....:.||||||||||:||.:|:..|:
  Rat    30 TASEH-RKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQR 93

  Fly    75 QRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQ 135
            .::....|..|..  |.|:|||:::...||:...||..|::.:..|.|   |||....|.|
  Rat    94 AQMTAALSTDPSV--LGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRL---LGHLANCMTQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 32/66 (48%)
ORANGE 91..135 CDD:128787 15/43 (35%)
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 6/14 (43%)
bHLH-O_HES1_4 33..95 CDD:381465 31/62 (50%)
Hairy_orange 110..148 CDD:400076 13/40 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281
WRPW motif 276..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.