DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus


Alignment Length:160 Identity:47/160 - (29%)
Similarity:77/160 - (48%) Gaps:18/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..|||||::||||:|..|.:||.|::..:.|:..:.||||||||||:||.:|: :|...|.:.
  Rat    14 RKSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVRFLR-EQPASVCST 77

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMAEE 145
            ::|.    :||.:..||......::.:......|:......|::.|..:           .::..
  Rat    78 EAPG----SLDSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLRQR-----------TVSGG 127

  Fly   146 PVNLADQKRSKSPREEDIHHGEE--VWRPW 173
            |.:|.....|.......:.....  :||||
  Rat   128 PPSLTPASASAPAPSPPVPPPSSLGLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 31/60 (52%)
ORANGE 91..135 CDD:128787 6/43 (14%)
Hes2NP_062109.1 HLH 12..69 CDD:238036 30/55 (55%)
ORANGE 84..128 CDD:128787 6/54 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 5/32 (16%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.