DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and HEYL

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_055386.2 Gene:HEYL / 26508 HGNCID:4882 Length:328 Species:Homo sapiens


Alignment Length:55 Identity:24/55 - (43%)
Similarity:39/55 - (70%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLK 70
            ||..:.::|::||.|:|..|.||:.|:....:.||.  ||||||::|::||::||
Human    44 RKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVLQMTVDHLK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 24/55 (44%)
ORANGE 91..135 CDD:128787
HEYLNP_055386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 4/12 (33%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 24/55 (44%)
HLH 42..100 CDD:238036 24/55 (44%)
ORANGE 115..162 CDD:128787
Atrophin-1 <136..311 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..308
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140921
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.