DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and lin-22

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_500281.1 Gene:lin-22 / 177082 WormBaseID:WBGene00003008 Length:173 Species:Caenorhabditis elegans


Alignment Length:66 Identity:33/66 - (50%)
Similarity:41/66 - (62%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANPQSPP 84
            |||:|:|||||:|..|.:||.:::........|.||.|||||||:.|.||   ||.|.|.|.|..
 Worm    26 KPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYL---QQLRSAQPCSLS 87

  Fly    85 P 85
            |
 Worm    88 P 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 28/56 (50%)
ORANGE 91..135 CDD:128787
lin-22NP_500281.1 bHLH_O_HES 29..82 CDD:381416 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.