powered by:
Protein Alignment E(spl)mdelta-HLH and lin-22
DIOPT Version :9
Sequence 1: | NP_524503.2 |
Gene: | E(spl)mdelta-HLH / 43150 |
FlyBaseID: | FBgn0002734 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500281.1 |
Gene: | lin-22 / 177082 |
WormBaseID: | WBGene00003008 |
Length: | 173 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 33/66 - (50%) |
Similarity: | 41/66 - (62%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 KPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANPQSPP 84
|||:|:|||||:|..|.:||.:::........|.||.|||||||:.|.|| ||.|.|.|.|..
Worm 26 KPLMEKKRRARINKSLSQLKQILIQDEHKNSIQHSKWEKADILEMAVEYL---QQLRSAQPCSLS 87
Fly 85 P 85
|
Worm 88 P 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4304 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000785 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.770 |
|
Return to query results.
Submit another query.