DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hey1

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_034553.2 Gene:Hey1 / 15213 MGIID:1341800 Length:299 Species:Mus musculus


Alignment Length:167 Identity:41/167 - (24%)
Similarity:67/167 - (40%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..:.::|::||.|:|..|.||:.|:....:.||.  :|||||:||::||::||  ........
Mouse    50 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGS--AKLEKAEILQMTVDHLK--MLHTAGGK 110

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMAEE 145
            .......:.:|....|:.:...||:...|.:.|||                           |.:
Mouse   111 GYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLD---------------------------ASD 148

  Fly   146 PV---------NLADQKRSKSPREEDIHHGEEVWRPW 173
            |:         |.|.|:.:.|.....:.|     .||
Mouse   149 PLRVRLVSHLNNYASQREAASGAHGGLGH-----IPW 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 24/60 (40%)
ORANGE 91..135 CDD:128787 8/43 (19%)
Hey1NP_034553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 2/2 (100%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 48..117 24/70 (34%)
HLH 50..107 CDD:238036 24/60 (40%)
ORANGE 120..166 CDD:128787 13/72 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..234
YRPW motif 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830844
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.