Sequence 1: | NP_524503.2 | Gene: | E(spl)mdelta-HLH / 43150 | FlyBaseID: | FBgn0002734 | Length: | 173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006538625.3 | Gene: | Hes5 / 15208 | MGIID: | 104876 | Length: | 415 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 77/207 - (37%) | Gaps: | 61/207 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 MTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQ 73
Fly 74 QQ-------------------------------RVANPQSPPPDQVNLDKFRAGYTQAAYEVSHI 107
Fly 108 FSTVPGLDLKFGTHLMKQLGHQLKD-----MKQEEEIIDMAEEPVN------LADQKRSKSPREE 161
Fly 162 DIHHGEEVWRPW 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)mdelta-HLH | NP_524503.2 | bHLH-O_ESMB_like | 9..77 | CDD:381584 | 26/98 (27%) |
ORANGE | 91..135 | CDD:128787 | 8/48 (17%) | ||
Hes5 | XP_006538625.3 | bHLH-O_HES5 | 236..292 | CDD:381467 | 25/56 (45%) |
ORANGE | 334..369 | CDD:128787 | 9/45 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830908 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |