DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus


Alignment Length:207 Identity:48/207 - (23%)
Similarity:77/207 - (37%) Gaps:61/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQ 73
            |...:...::.||::|:.||.|:|..:::|| |:::...|:.:..||||||||||:.|:|||..:
Mouse   228 MLSPKEKNRLRKPVVEKMRRDRINSSIEQLK-LLLEQEFARHQPNSKLEKADILEMAVSYLKHSK 291

  Fly    74 QQ-------------------------------RVANPQSPPPDQVNLDKFRAGYTQAAYEVSHI 107
            .:                               ..|.|:|...|      :..||:....|....
Mouse   292 GEPGACARLLLPADVAPTARAPLMPLRLPTAFAAAAGPKSLHQD------YSEGYSWCLQEAVQF 350

  Fly   108 FSTVPGLDLKFGTHLMKQLGHQLKD-----MKQEEEIIDMAEEPVN------LADQKRSKSPREE 161
            .:.....|.:     ||.|.|..:.     ..:|......|.:|..      .|....|:.|   
Mouse   351 LTLHAASDTQ-----MKLLYHFQRPPAPAAPAKEPPAPGAAPQPARSSAKAAAAAVSTSRQP--- 407

  Fly   162 DIHHGEEVWRPW 173
                ...:||||
Mouse   408 ----ACGLWRPW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 26/98 (27%)
ORANGE 91..135 CDD:128787 8/48 (17%)
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 25/56 (45%)
ORANGE 334..369 CDD:128787 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.