DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes3

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_011248491.1 Gene:Hes3 / 15207 MGIID:104877 Length:291 Species:Mus musculus


Alignment Length:195 Identity:52/195 - (26%)
Similarity:76/195 - (38%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANPQS 82
            ::|||:|:|||||:|:.|::|:.|:......|..: .||||||||||:|.|:::.|..  .....
Mouse   112 ISKPLMEKKRRARINVSLEQLRSLLERHYSHQIRK-RKLEKADILELSVKYMRSLQNS--LQGLW 173

  Fly    83 PPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMAE--- 144
            |.|..|:   :.:|:......||.......| |......|:.|        ::|....|.|.   
Mouse   174 PVPSGVD---YPSGFQGGLRGVSQRLRPGEG-DSGLRCPLLLQ--------RREGSTTDSANPQA 226

  Fly   145 ------------EPVNLADQKRS-KSP-----------------------REEDIHHGEEVWRPW 173
                        .|...|....| :||                       :.|....|..|||||
Mouse   227 TSVLNPCLPAIWAPSRAAGGSHSPQSPLPLPGGLLESSTDVVAPHPASNCQAESTRPGFRVWRPW 291

  Fly   174  173
            Mouse   292  291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 27/58 (47%)
ORANGE 91..135 CDD:128787 7/43 (16%)
Hes3XP_011248491.1 bHLH-O_HES3 117..171 CDD:381503 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.