DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001288734.1 Gene:Hes2 / 15206 MGIID:1098624 Length:157 Species:Mus musculus


Alignment Length:159 Identity:46/159 - (28%)
Similarity:79/159 - (49%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..|||||::||||:|..|.:||.|::..:.|:..:.||||||||||:||.:|: :|...:.:.
Mouse    14 RKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFLQ-EQPATLYSS 77

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMAEE 145
            .:|.|    |:.:..||......::.:......|:......|::.|  :.:.:..:...:.:...
Mouse    78 AAPGP----LNSYLEGYRACLARLARVLPACSVLEPAVSARLLEHL--RQRTVSDDSPSLTLPPA 136

  Fly   146 PVNLADQKRSKSPREEDIHHGEE-VWRPW 173
            |        :.:|.......|.. :||||
Mouse   137 P--------APAPSPPVPPPGSSGLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 31/60 (52%)
ORANGE 91..135 CDD:128787 5/43 (12%)
Hes2NP_001288734.1 bHLH_SF 10..73 CDD:381792 31/59 (53%)
ORANGE 85..123 CDD:128787 5/39 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 5/40 (13%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830892
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5264
Isobase 1 0.950 - 0 Normalized mean entropy S5317
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.