DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and her9

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_571948.1 Gene:her9 / 140613 ZFINID:ZDB-GENE-011213-1 Length:291 Species:Danio rerio


Alignment Length:162 Identity:53/162 - (32%)
Similarity:81/162 - (50%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVAN 79
            :||.:||::|::||||:|..|.:||.||:|.:.....:.||||||||||:||.:|:  ..|||..
Zfish    34 HRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLR--NLQRVQM 96

  Fly    80 PQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLG----------------H 128
            ..:...|...|.|:|||:.:...||:...||..|::.:..:.|:..|.                .
Zfish    97 SAALSADTNVLSKYRAGFNECMNEVTRFLSTCEGVNTEVRSRLLNHLSGCMGQMMAMNYPQPAPA 161

  Fly   129 QLKDMKQEEEIIDMAEEPVNLADQKRSKSPRE 160
            |...:.|...:...:..|:|.|......||.|
Zfish   162 QQAHLAQPLHVQLPSTLPINGASMGSKLSPSE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 30/61 (49%)
ORANGE 91..135 CDD:128787 12/59 (20%)
her9NP_571948.1 HLH 32..93 CDD:238036 29/60 (48%)
Hairy_orange 110..147 CDD:284859 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.