DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes5.8

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_002933896.1 Gene:hes5.8 / 100495414 XenbaseID:XB-GENE-22064040 Length:145 Species:Xenopus tropicalis


Alignment Length:163 Identity:41/163 - (25%)
Similarity:71/163 - (43%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||:.||::|:.||.|:|..:::|:.|:....: :....||.|||||||:.|.:|    ||.:|. 
 Frog    15 RKIRKPVVEKMRRDRINSSIEQLRMLLEKEFE-KHNLPSKPEKADILEVAVGFL----QQHIAT- 73

  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQL-----GHQLKDMKQEEEII 140
               ..|:::...::.||::...:..|..|.       ...|....|     |||....:..:..:
 Frog    74 ---KTDEISGKSYKEGYSKCVEDSVHFLSA-------HNQHSQGNLLRSFHGHQFSSGETHQSRL 128

  Fly   141 DMAEEPVNLADQKRSKSPREEDIHHGEEVWRPW 173
            ...:.||.                :.:.:||||
 Frog   129 CHGQSPVT----------------NSKVLWRPW 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 24/60 (40%)
ORANGE 91..135 CDD:128787 9/48 (19%)
hes5.8XP_002933896.1 bHLH-O_HES5 16..72 CDD:381467 23/60 (38%)
Hairy_orange 81..>106 CDD:383064 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.