DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes5.5

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001165751.1 Gene:hes5.5 / 100337645 XenbaseID:XB-GENE-6492485 Length:158 Species:Xenopus tropicalis


Alignment Length:169 Identity:47/169 - (27%)
Similarity:74/169 - (43%) Gaps:34/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQ 75
            |.|..||:.||::|:.||.|:|..:::|:.|:....|:. ...||.|||||||:.|:::  |||.
 Frog    17 KAQGIRKMRKPVVEKMRRDRINSSIEQLRMLLEKEFDSH-HLPSKPEKADILEVAVSFM--QQQM 78

  Fly    76 RVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEII 140
            .....||....|:.      ||::...:..|..|.                   .|..:...::|
 Frog    79 ATKCKQSSSAPQME------GYSKCLQDSLHFLSL-------------------QKHAELHRKVI 118

  Fly   141 DMAEEPVNLADQK-RSKSPREEDIHHG-----EEVWRPW 173
            ....|..:|:... ||.||..:....|     :.:||||
 Frog   119 QNFHENHSLSQGLCRSVSPYYQTPTIGTAPPAKLLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 27/65 (42%)
ORANGE 91..135 CDD:128787 5/43 (12%)
hes5.5NP_001165751.1 bHLH-O_HES5 23..77 CDD:381467 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.