DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes5.4

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_002933895.2 Gene:hes5.4 / 100271766 XenbaseID:XB-GENE-5952810 Length:159 Species:Xenopus tropicalis


Alignment Length:160 Identity:45/160 - (28%)
Similarity:77/160 - (48%) Gaps:24/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQ--RVA 78
            |::.||::|:.||.|:|..:.:|: ::::....:.:..||||||||||:||||||..|.|  .||
 Frog    22 RQIRKPVVEKMRRDRINSSIKQLR-MLLEKEFQRHQPNSKLEKADILEMTVNYLKEHQLQMNAVA 85

  Fly    79 NPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMA 143
            ..:..|     ...:..||::...|.           |:|.:|...|....||.::.....:   
 Frog    86 FARKSP-----FQDYNQGYSRCLEET-----------LQFLSHTEMQKPANLKLVQHFNRTV--- 131

  Fly   144 EEPVNLADQKRSKSPREEDIHHGEEVWRPW 173
              |.:....:.:.|.::...:....:||||
 Frog   132 --PADNNLPQGAPSLKQPSSNTAAIIWRPW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 27/62 (44%)
ORANGE 91..135 CDD:128787 9/43 (21%)
hes5.4XP_002933895.2 bHLH-O_HES5 23..81 CDD:381467 25/58 (43%)
Hairy_orange 93..129 CDD:413415 9/46 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5183
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.