DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes6.1

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_017949954.1 Gene:hes6.1 / 100126814 XenbaseID:XB-GENE-1018104 Length:195 Species:Xenopus tropicalis


Alignment Length:193 Identity:56/193 - (29%)
Similarity:89/193 - (46%) Gaps:54/193 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANPQSPP 84
            |||:|::||||:|..|.:|:.::.||     |..||:|.|::|||||     ::.:|:...::..
 Frog    18 KPLVEKRRRARINESLQDLRGILSDT-----EFQSKMENAEVLELTV-----KRVERILRNRTAE 72

  Fly    85 PDQVN---LDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEE-----IID 141
            .|::.   .::|.|||.|..:||....|:.||:|......|   |.|.|:.|...|.     ::|
 Frog    73 ADRLQREASERFAAGYIQCMHEVHTFVSSCPGIDASLAAEL---LNHLLESMPLSEGSLQDLVMD 134

  Fly   142 M------AEEPVNL----ADQKRSKSPREEDIHHGEE---------------------VWRPW 173
            :      :||...|    :..:.|.|..||.  .||:                     :||||
 Frog   135 VLLDSTSSEEGCGLGVLGSSSEDSCSDMEES--EGEKAGMGSVQDSGRTPEIQPPTPTMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 23/56 (41%)
ORANGE 91..135 CDD:128787 16/43 (37%)
hes6.1XP_017949954.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.