DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)mdelta-HLH and hes2

DIOPT Version :9

Sequence 1:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:175 Identity:52/175 - (29%)
Similarity:75/175 - (42%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80
            ||..|||:|::||||:|..|::||.||:..:.....:.||||||||||:||.:|:          
 Frog    29 RKTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEKADILEMTVRFLR---------- 83

  Fly    81 QSPP-PDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQL----------------GH 128
            ..|| |.|...|:::.||......:|.|.:....|..:....|:..|                .|
 Frog    84 DIPPVPAQNPADRYKEGYRACVERLSAILNKSHVLTGEASNRLLNHLQRSPELCCSDCHHPPKSH 148

  Fly   129 QLKDMKQEEEIIDMAEEPVNLADQKRSKSPREEDIHHGEEVWRPW 173
            ..:.:..........|.|  |.:|..|..|..........:||||
 Frog   149 SPRIVLHVSPRTSQLESP--LLNQPSSHRPAPCPPQLNSSIWRPW 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 29/60 (48%)
ORANGE 91..135 CDD:128787 9/59 (15%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 31/69 (45%)
Hairy_orange 97..133 CDD:369405 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.