DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf1 and RASA2

DIOPT Version :9

Sequence 1:NP_733132.2 Gene:Nf1 / 43149 FlyBaseID:FBgn0015269 Length:2802 Species:Drosophila melanogaster
Sequence 2:XP_016862457.1 Gene:RASA2 / 5922 HGNCID:9872 Length:872 Species:Homo sapiens


Alignment Length:605 Identity:125/605 - (20%)
Similarity:223/605 - (36%) Gaps:179/605 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1214 NPDLQ---TRAAFMEVLTQILQQGTEFDTLAETVLADRFEQLVQLVTMISDKGEL-PIAMALANV 1274
            :||:|   ..||:  :|::|.:              |:.:.::.||.::....:| |.|.|:|  
Human   358 SPDVQPISASAAY--ILSEICR--------------DKNDAVLPLVRLLLHHDKLVPFATAVA-- 404

  Fly  1275 VTTSQMDELARVLVTLFDAKHLLSPLLWNMFYREVEVSDCM--QTLFRGNSLGSKIMAFCFKIYG 1337
                                             |:::.|..  .|:||||||.::.:....||.|
Human   405 ---------------------------------ELDLKDTQDANTIFRGNSLATRCLDEMMKIVG 436

  Fly  1338 ASYLQMLLEPLIRPLLDEEEETCFEVDPARLDPTEDIEQHRNNLIALTQKVFDAIINSSDRFPPQ 1402
            ..||::.|:|::..:.| ..::| |:||.:|...:::|.::.||.....|:|:.|:.||...|..
Human   437 GHYLKVTLKPILDEICD-SSKSC-EIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTV 499

  Fly  1403 LRSMCHCLYQVLSKRFPNLLQNNIGAVGTVIFLRFINPAIVSPQELGIVDKQVHSSAKRGLMLMS 1467
            :..:.:.|.|:.::||||.......||.:.:||||...|:|||....:......:...|.|.|:|
Human   500 MCDIFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTLIS 564

  Fly  1468 KILQNIANHVEFSK-----EQHMLC--FNDFLRDHFEAGRRFFIQIASDCETVDQTSHSMSFISD 1525
            |.:|.:.:....||     ::..:|  |..|..:.:....:.|:...|..||.:.:..|.     
Human   565 KTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSE----- 624

  Fly  1526 ANVLALHRLLWTHQEKIGDYLSSSRDHKAVGRRPFDKMATLLAYLGPPEHKPVDSHMMFSSYARW 1590
                .:|.       |.|:....::....:|::.|.|                          ||
Human   625 ----PVHL-------KEGEMYKRAQGRTRIGKKNFKK--------------------------RW 652

  Fly  1591 SSIDMSSTNFEEIMVKHQMHEKEEFKTLKSMNIFYQAGTSKSGYPVFYYIARRYKIGETNGDLLI 1655
            ..:     ...|:....|...|:...|:...||.......:|.:            .:.|    :
Human   653 FCL-----TSRELTYHKQPGSKDAIYTIPVKNILAVEKLEESSF------------NKKN----M 696

  Fly  1656 YHVILTLKPFCHSPFEVVIDFTHTCSDNRFRTEFLQKWFYVLPTVAYENVHAVYIYNCNSWVREY 1720
            :.||.|.||....        .:.|.:       ..:|..||..|:          .||.  ...
Human   697 FQVIHTEKPLYVQ--------ANNCVE-------ANEWIDVLCRVS----------RCNQ--NRL 734

  Fly  1721 TKFHDRILAPLKGNRKLLFLESPNKL-----TDFIDAEQQKLPGATLSLDEDL---KVFS----N 1773
            :.:|..:.  |.||.........|.|     |..:.|:.|      :.:|||.   :::|    :
Human   735 SFYHPSVY--LNGNWLCCQETGENTLGCKPCTAGVPADIQ------IDIDEDRETERIYSLFTLS 791

  Fly  1774 ALKLSHKDT---KVAIKVGP 1790
            .|||...:.   .:|:..||
Human   792 LLKLQKMEEACGTIAVYQGP 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf1NP_733132.2 RasGAP_Neurofibromin 1242..1575 CDD:213332 77/342 (23%)
CRAL_TRIO_2 1633..1767 CDD:404584 23/138 (17%)
PH_NF1 1759..1868 CDD:270123 10/42 (24%)
MOR2-PAG1_mid <1931..>2109 CDD:372971
RASA2XP_016862457.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R472
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.