DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf1 and Nek2

DIOPT Version :9

Sequence 1:NP_733132.2 Gene:Nf1 / 43149 FlyBaseID:FBgn0015269 Length:2802 Species:Drosophila melanogaster
Sequence 2:NP_446143.1 Gene:Nek2 / 114482 RGDID:619792 Length:443 Species:Rattus norvegicus


Alignment Length:410 Identity:73/410 - (17%)
Similarity:128/410 - (31%) Gaps:146/410 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1590 WSSIDMSS-TNFEEIMVKHQMHEKEEFKTLKSMNI--FYQAGTSKSGYPVFYYIARRYKIGETNG 1651
            |..:|..| |..|:.|:   :.|....:.||..||  :|.....::...:  ||...|..|   |
  Rat    36 WKELDYGSMTEVEKQML---VSEVNLLRELKHPNIVRYYDRIIDRTNTTL--YIVMEYCEG---G 92

  Fly  1652 DL---------------------LIYHVILTLKPFCH--------------SPFEVVIDFTHTCS 1681
            ||                     ::..:.|.||. ||              .|..|.:|..|...
  Rat    93 DLASVITKGTKDRQYLEEEFVLRVMTQLTLALKE-CHRRSDGGHTVLHRDLKPANVFLDSKHNVK 156

  Fly  1682 ------------DNRFRTEFLQKWFYVLP----TVAYENVHAVY-----IYNCNSWVREYTKFHD 1725
                        |..|...|:...:|:.|    .::|.....::     :|...:.:..:|.|:.
  Rat   157 LGDFGLARILNHDTSFAKTFVGTPYYMSPEQISRLSYNEKSDIWSLGCLLYELCALMPPFTAFNQ 221

  Fly  1726 RILA-----------PLK---GNRKLL----------------FLESPNKLTDFIDAEQQ----- 1755
            :.||           |.:   |...|:                .|||| .:.|.:..||:     
  Rat   222 KELAGKIREGRFRRIPYRYSDGLNDLITRMLNLKDYHRPSVEEILESP-LIADLVAEEQRRNLER 285

  Fly  1756 --KLPGATLSLDEDLKVFSNALKLSHK---DTKVAIKVGPTALQITSAE--------KTKVLAHS 1807
              :..|....|.:...|.|. |||..:   |.:.|::....:|:....|        :.|:....
  Rat   286 RGRRSGEPSKLQDSSPVLSE-LKLKERQLQDRERALRAREDSLEQKERELCIRERLAEDKLARAE 349

  Fly  1808 VLLNDVYYASEIEEVCLVDDNQFTL------------------SITNESGQLSFIHNDCDNI--- 1851
            .||.:.....|...:||...::..|                  :..:|:.:.....:.|.::   
  Rat   350 SLLKNYSLLKEHRLLCLAGGSELDLPSSALKKKVHFHGESKENTARSENSESQLAKSKCRDLKKR 414

  Fly  1852 -------VQAIIHIRNRWEL 1864
                   .||:..|...::|
  Rat   415 LHAAQLRAQALSDIEKNYQL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf1NP_733132.2 RasGAP_Neurofibromin 1242..1575 CDD:213332
CRAL_TRIO_2 1633..1767 CDD:404584 39/226 (17%)
PH_NF1 1759..1868 CDD:270123 24/145 (17%)
MOR2-PAG1_mid <1931..>2109 CDD:372971
Nek2NP_446143.1 STKc_Nek2 7..271 CDD:270857 46/244 (19%)
S_TKc 8..271 CDD:214567 46/244 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1826
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.