DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fid and CG6144

DIOPT Version :10

Sequence 1:NP_651453.3 Gene:fid / 43148 FlyBaseID:FBgn0259146 Length:1391 Species:Drosophila melanogaster
Sequence 2:NP_609414.3 Gene:CG6144 / 34443 FlyBaseID:FBgn0032259 Length:228 Species:Drosophila melanogaster


Alignment Length:117 Identity:26/117 - (22%)
Similarity:47/117 - (40%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 AKDLPIELRRLEDFEDFPDPPLSAGL-KSRSLGSILQPPPRQIVRSRSSVPSLGGPLI-PGESKA 434
            |:::|      |..:.:.|...:.|: :|::...:|   ..:.:..:..:|...|||. |..|..
  Fly    64 AEEIP------EWLQTYVDKVNNLGVFESQNANHVL---VNEYLPGQGILPHTDGPLFHPIISTI 119

  Fly   435 SAAALLLNNPESQQLQLQLQLNGRHSPTTTASAGNTLSRRP--KLIKQKQSL 484
            |..|           ...|:...|...||...||:..:|..  ||:.:.:||
  Fly   120 STGA-----------HTVLEFVKREDTTTETEAGDQTTREVLFKLLLEPRSL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fidNP_651453.3 UbiE 158..261 CDD:441828
CG6144NP_609414.3 2OG-FeII_Oxy 15..215 CDD:473886 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.