DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boss and Gprc5d

DIOPT Version :9

Sequence 1:NP_542440.1 Gene:boss / 43146 FlyBaseID:FBgn0000206 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001192325.1 Gene:Gprc5d / 93746 MGIID:1935037 Length:344 Species:Mus musculus


Alignment Length:410 Identity:88/410 - (21%)
Similarity:155/410 - (37%) Gaps:115/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 NCQYSAGDNRRYPFLFDGESVMFWRIKMDTWVATGLTAAILGLIAT-LAILVFIVVRISLGDVFE 563
            :|..|..|   |....|.|..  |.|.::       :.|::|::.| |.:|.|:.:...:.|..:
Mouse     4 DCVKSTED---YYLFCDNEGP--WAIVLE-------SLAVIGIVVTILLLLAFLFLMRKVQDCSQ 56

  Fly   564 GNP-TTSILLLLSLILVFCSFVPYSIEYVGEQRNSHVTFEDAQTLNTLCA-VRVFIMTLVYCFVF 626
            .|. .|..|.||:::.:|                 .:||.....||...| ||.|:..:::...|
Mouse    57 WNVLPTQFLFLLAVLGLF-----------------GLTFAFIIQLNHQTAPVRYFLFGVLFAICF 104

  Fly   627 SLLLCRAVMLASIGSEGGFLSHVNGYIQAVICAFSVVAQVGMSVQLLVVMHVASETVS------- 684
            |.||..|..|..:         |.|.:.  .| ::.:..:.:.|.||..: :|.|.|:       
Mouse   105 SCLLAHASNLVKL---------VRGRVS--FC-WTTILFIAIGVSLLQTI-IAIEYVTLIMTRGL 156

  Fly   685 ---------------CENIYYGRWLWGLLAYDF----ALLC--CVGALIPSIYRSQRNYREGILI 728
                           |..||    :..|:|..|    |..|  |            .|:::...:
Mouse   157 MFEHMTPYQLNVDFVCLLIY----VLFLMALTFFVSKATFCGPC------------ENWKQHGRL 205

  Fly   729 VIGSVLI-MVIWVAWIALSLFGD-------EWRDAAIPLGLQASGWAVLVGILIPRTFLIVRGIE 785
            :..:||: ::|||.||::.|.|:       .|.||.|.:||..:.|..|:..:||...::.|...
Mouse   206 IFATVLVSIIIWVVWISMLLRGNPQLQRQPHWDDAVICIGLVTNAWVFLLIYIIPELSILYRSCR 270

  Fly   786 RSDIAQALPSLTSLAFAQNNQYSSEQSVYECVNPAMRHCSQDEV---NHQSPSEIPTLPLRGGGP 847
                 |..|:..::......|.|......|.........:|::|   .:.:|     :.|:...|
Mouse   271 -----QECPTQGNVCQVPVYQRSFRMDTQEPTRARDSDGAQEDVALTAYGTP-----IQLQSADP 325

  Fly   848 RRQQFFANLRQANANINPQR 867
            .|:...     .:|.::||:
Mouse   326 SREYLI-----PSATLSPQQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bossNP_542440.1 7tm_3 <692..779 CDD:278433 26/100 (26%)
Gprc5dNP_001192325.1 7tm_3 61..264 CDD:278433 57/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.