DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boss and GPRC5A

DIOPT Version :9

Sequence 1:NP_542440.1 Gene:boss / 43146 FlyBaseID:FBgn0000206 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_003970.1 Gene:GPRC5A / 9052 HGNCID:9836 Length:357 Species:Homo sapiens


Alignment Length:336 Identity:74/336 - (22%)
Similarity:125/336 - (37%) Gaps:82/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 DGESVMFWRI--KMDTWVATGLTAAILGLIATLAILVFIVVRISLGDVFEGNP----TTSILLLL 574
            :|....::|:  |.:.|.....|.|..|::.::|.::.:.:.:.  .|.:.|.    .|..|.||
Human    11 NGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVC--KVQDSNRRKMLPTQFLFLL 73

  Fly   575 SLILVFCSFVPYSIEYVGEQRNSHVTFE-----DAQTLNTLCAVRVFIMTLVYCFVFSLLLCRAV 634
            .::.:|                 .:||.     |..|..|    |.|:..:::...||.||..||
Human    74 GVLGIF-----------------GLTFAFIIGLDGSTGPT----RFFLFGILFSICFSCLLAHAV 117

  Fly   635 MLASIGSEGGFLSHVNG-------YIQAVICAFSVVAQVGMSVQLLVVMHVASETVSCENIYYGR 692
            .|..:         |.|       .|..:...||:|..|.....:::.|:..:..|..|      
Human   118 SLTKL---------VRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSE------ 167

  Fly   693 WLWGLLA----YDFALLCCVGALIPSIYRSQRNY----------REGILIVIGSVLIMVIWVAWI 743
                |.|    .||.||......:.::.....::          |.|..|.:..:|.:.||||||
Human   168 ----LSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWI 228

  Fly   744 ALSLFGD---EWRDAAIPLGLQASGWAVLVGILIPRTFLIVRGIERSDI----AQALPSLTSLAF 801
            .|.:..|   .|.|..:...|.|:||..|:..:.|..:|:.:.....|.    |...|.|...::
Human   229 TLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSY 293

  Fly   802 -AQNNQYSSEQ 811
             .:|..||.|:
Human   294 GVENRAYSQEE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bossNP_542440.1 7tm_3 <692..779 CDD:278433 26/103 (25%)
GPRC5ANP_003970.1 7tmC_RAIG1_4_GPRC5A_D 26..270 CDD:320406 63/285 (22%)
TM helix 1 27..51 CDD:320406 5/23 (22%)
TM helix 2 65..86 CDD:320406 7/37 (19%)
TM helix 3 95..117 CDD:320406 7/25 (28%)
TM helix 4 136..152 CDD:320406 4/15 (27%)
TM helix 5 173..196 CDD:320406 4/22 (18%)
TM helix 6 210..232 CDD:320406 10/21 (48%)
TM helix 7 239..264 CDD:320406 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.