DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boss and Gprc5a

DIOPT Version :9

Sequence 1:NP_542440.1 Gene:boss / 43146 FlyBaseID:FBgn0000206 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001073359.1 Gene:Gprc5a / 312790 RGDID:1310804 Length:358 Species:Rattus norvegicus


Alignment Length:335 Identity:85/335 - (25%)
Similarity:138/335 - (41%) Gaps:74/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 DNRRYPF--LFDGESVMFWRIKMDTWVATGLTAAILGLIATLAILVFIVVRISLGDVFEGNPTTS 569
            |:|.|..  |.:|     |.|.::|..|.|..|.    :|.:..|||::.::......:..| |.
  Rat    17 DSRYYRLCDLAEG-----WGIALETLAAVGAVAT----VALMFALVFLICKVQDSSKRKMLP-TQ 71

  Fly   570 ILLLLSLILVFCSFVPYSIEYVGEQRNSHVTFEDAQTLNTLCAVRVFIMTLVYCFVFSLLLCRAV 634
            .|.||.::.||.....:.|:.            |..|..|    |.|:..:::...||.||..|.
  Rat    72 FLFLLGVLGVFGLTFAFIIKL------------DRATGPT----RFFLFGVLFALCFSCLLAHAF 120

  Fly   635 MLASIGSEGGFLSHVNG-------YIQAVICAFSVVAQVGMSVQLLVV------MHVASETVSCE 686
            .|..:         |.|       .|.::...||:|..| ::::.||:      ::|.|:..:..
  Rat   121 NLIKL---------VRGRKPLSWLVILSLAVGFSLVQDV-IAIEFLVLTMNRTNVNVFSQLPAPR 175

  Fly   687 N-------IYYGRWLWGLLAYDFALLCCVGALIPSIYRSQRNYREGILIVIGSVLIMVIWVAWIA 744
            .       :.|..:|. :|.:..:||...|:.  |.::     |.||.|.:.|.|.:.||||||.
  Rat   176 RNEDFVMLLIYVLFLM-VLTFVASLLVFCGSF--SGWK-----RHGIHICLTSFLSIAIWVAWII 232

  Fly   745 LSLFGD---EWRDAAIPLGLQASGWAVLVGILIPRTFLIVRGIERSDI----AQALPSLTSLAF- 801
            |.|..|   :|.|..:...|.|:||..||..::|....:.|....:|.    |...|.|...:: 
  Rat   233 LLLIPDIDRKWDDTILSTVLVANGWVFLVFYILPEFRQLPRQRSSTDYPVEDAFCKPQLMKQSYG 297

  Fly   802 AQNNQYSSEQ 811
            .:|..||.|:
  Rat   298 VENRAYSQEE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bossNP_542440.1 7tm_3 <692..779 CDD:278433 30/89 (34%)
Gprc5aNP_001073359.1 7tm_3 48..268 CDD:278433 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.