DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31089 and AT1G15060

DIOPT Version :9

Sequence 1:NP_733128.1 Gene:CG31089 / 43135 FlyBaseID:FBgn0051089 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:212 Identity:36/212 - (16%)
Similarity:71/212 - (33%) Gaps:89/212 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PEYNDKIKTAHMFAPVAIMKNLSSGLVRSVGPYLGHRNTYSVLFGSQEFLPHNEFLMAIFFNICQ 266
            |::..:|::|...|...:..:.|...|.:. |...||.|                          
plant     6 PQFPLEIRSALRRASSTVYLHRSISTVTTT-PSFRHRTT-------------------------- 43

  Fly   267 PDFMLRPVCESAMEKLYAGGRVNMTAMPEGMATHPAGCSTDQMLHYLQEQQSGYFRLFDHGTKKN 331
               :|||       :.::...|.       :.|.|:.|:.|: |||:....:.:          .
plant    44 ---LLRP-------RAFSSSSVK-------LPTKPSLCTADE-LHYVSVPNTDW----------R 80

  Fly   332 LEVYGTQEPPE-----YPVELINSL----------------VHM-------WYAD------SDNL 362
            |.::....||:     :|:.|::.:                .||       |..:      |..:
plant    81 LALWRYLPPPQAPTRNHPLLLLSGVGTNAIGYDLSPGCSFARHMSGQGFETWILEVRGAGLSTRV 145

  Fly   363 AAVEDVEQIAERLPNKV 379
            :.::|||:.|..|.|::
plant   146 SDLKDVEESAHELSNQI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31089NP_733128.1 Abhydro_lipase 48..110 CDD:282003
Abhydrolase <86..>237 CDD:304388 7/34 (21%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.