DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31089 and CG17097

DIOPT Version :9

Sequence 1:NP_733128.1 Gene:CG31089 / 43135 FlyBaseID:FBgn0051089 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:405 Identity:133/405 - (32%)
Similarity:200/405 - (49%) Gaps:38/405 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YKLYDNP----EAHISLKSKITTADRTAAHGYPSEHHHIVTEDGYILGVFRIPYSHKLQNQNEKR 90
            ||::..|    :..|...:|:||.|....:|||||.:::.:||||.|.:.|||           |
  Fly   704 YKVFKTPNYLTQEDILDNTKLTTVDLIEKYGYPSETNYVTSEDGYRLCLHRIP-----------R 757

  Fly    91 P---IVLLQHGLTSCSDAWILQGPNDGLPYLLADAGFDVWMGNARGTSYSRNHTT--LSPDHPNF 150
            |   .|||.|||.:.|.:|:..||.|||.|:|...|:||||.|.||..|||.:..  |.|:  .:
  Fly   758 PGAEPVLLVHGLMASSASWVELGPKDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPN--KY 820

  Fly   151 WKFSWHEIGIYDITAIIDYALSTENGQGQDAIHYVGHSQGTTVFFALMSWIPEYNDKIKTAHMFA 215
            |.||:||||.:|:.|.||:.|...:   :..|.|:|||||:||||.:.|..|.|..|:......:
  Fly   821 WDFSFHEIGKFDVPAAIDHILIHTH---KPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALS 882

  Fly   216 PVAIMKNLSSGLVRSVGPYLGHRNTYSVLFGSQEFLPHNEFLMAIFFNICQPDFMLRPVCESAME 280
            |...::...|.:::.:|.:.|..:....|.|..|.....:.:.....:||....:...:| :..:
  Fly   883 PTVYLQENRSPVLKFLGMFKGKYSMLLNLLGGYEISAKTKLIQQFRQHICSGSELGSSIC-AIFD 946

  Fly   281 KLYAG---GRVNMTAMPEGMATHPAGCSTDQMLHYLQEQQSGYFRLFDHGTKKNLEVYGTQEPPE 342
            .:..|   ...|.|..|...|....|.|..|:.||.|.|....|:.||||...|...|.:.|||.
  Fly   947 FVLCGFDWKSFNTTLTPIVAAHASQGASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPA 1011

  Fly   343 YPVELINSLVHMWYADSDNLAAVEDVEQIAERLPNKVMHRMADTE-WNHGDFALNWEVRKYINEP 406
            |.:....|.|.:.:.:.|.|.:..||.::.|||||.|..|..:.| ::|.||.|:.:||      
  Fly  1012 YNLSQTTSKVVLHHGEGDWLGSTSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVR------ 1070

  Fly   407 VIDIMMEYELKNIGT 421
              .::..:.|:::.|
  Fly  1071 --PLLYSHVLRHLST 1083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31089NP_733128.1 Abhydro_lipase 48..110 CDD:282003 25/64 (39%)
Abhydrolase <86..>237 CDD:304388 60/155 (39%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 25/64 (39%)
MhpC 746..1061 CDD:223669 111/331 (34%)
Abhydrolase_5 762..>899 CDD:289465 57/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439511
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.