DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco3 and CG32554

DIOPT Version :10

Sequence 1:NP_651441.1 Gene:Mco3 / 43134 FlyBaseID:FBgn0039387 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_728102.1 Gene:CG32554 / 32767 FlyBaseID:FBgn0052554 Length:239 Species:Drosophila melanogaster


Alignment Length:177 Identity:33/177 - (18%)
Similarity:63/177 - (35%) Gaps:42/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 ISTDGNDIEPVLADGFFLTSAERFDFVLEANQYKKNYWIRIKG--YEQCENRNIYQGAVLSYRGS 411
            ::|..::.:||.::.:..........:..:.:.:.:.|.|:.|  .||.|               
  Fly    53 LATRKDEAQPVKSERYVEDQDAPASDLQISQEMQTHIWRRLSGIIQEQIE--------------- 102

  Fly   412 ARSELPQGDILDKPS----SRAADEDLILVNDFRFK-PANSTAISSLRQSLDKDNNVGTVALRSV 471
            ...::|.|....||.    ...::.|..|:.|...: ||......::|:...:::.....||.||
  Fly   103 FSLDVPNGVGKQKPPPDKVKLVSNADCYLIADLVVEGPAGPKKKPNIRRRTPEEDQSAPEALDSV 167

  Fly   472 -----------DPVPW----TRYTKFLTHYSSFGSRTAPNGEVLFQI 503
                       |.:.|    ||:.|...:.:|     .||...|..|
  Fly   168 VVTGNSILEGRDLLAWAQKKTRHDKVFQYRAS-----DPNATKLVAI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco3NP_651441.1 CuRO_1_tcLCC2_insect_like 149..252 CDD:259927
laccase 151..656 CDD:274556 33/177 (19%)
CuRO_2_tcLCC_insect_like 270..408 CDD:259951 9/60 (15%)
CG32554NP_728102.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.