DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and CSD2

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_565666.1 Gene:CSD2 / 817365 AraportID:AT2G28190 Length:216 Species:Arabidopsis thaliana


Alignment Length:172 Identity:52/172 - (30%)
Similarity:71/172 - (41%) Gaps:44/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QAGAKLMGDGEGAGVAGMISFVQLPYNSDIRVTINVTGLPPGKHALHIHTFGDLSDGCKSTGGQF 158
            :|.|.|.|..:   |.|:::..| ..:....|.:.:|||.||.|..|:|.|||.::||.|||..|
plant    66 KAVAVLKGTSD---VEGVVTLTQ-DDSGPTTVNVRITGLTPGPHGFHLHEFGDTTNGCISTGPHF 126

  Fly   159 -PNNF--------------LGNVDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLNTA 208
             |||.              |||::...||..........:.|.|.|.:|||:.|:|....||...
plant   127 NPNNMTHGAPEDECRHAGDLGNINANADGVAETTIVDNQIPLTGPNSVVGRAFVVHELKDDLGKG 191

  Fly   209 LNAEVFSSSLQAMPNPLAYQNEENSL-----GPAIACGVISI 245
                                ..|.||     |..:|||||.:
plant   192 --------------------GHELSLTTGNAGGRLACGVIGL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 46/154 (30%)
CSD2NP_565666.1 Cu-Zn_Superoxide_Dismutase 66..213 CDD:412632 52/170 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.